The short version of LC-MS/MS fits in a sentence. The long version — which is the one that helps — is below.
This page was last updated on 2026-02-20 and is reviewed periodically as new material appears.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
Commercial AOD-9604 may vary in purity, counterion content, and residual moisture. Certificates of analysis often report HPLC purity, mass confirmation, and appearance, but testing methods differ between suppliers. Independent verification is sometimes used because labeled content may not match actual peptide amount. Stability under different pH and temperature conditions is not fully standardized across studies. Researchers generally treat lyophilized material as the reference form for weighing and reconstitution. Moisture content can affect accurate mass measurement.
AOD-9604 is typically supplied as a lyophilized white to off-white powder. In this form, it is relatively stable when kept cool, dry, and protected from light. Common storage recommendations place it at −20 °C or below for long-term retention. Reconstituted solutions are less stable and are often kept at 2–8 °C for short periods. Freeze-thaw cycles should be minimized because they can promote aggregation or loss of peptide content. Vials are usually sealed under inert gas to reduce oxidation.
Identity and purity are commonly checked with reversed-phase high-performance liquid chromatography and mass spectrometry. RP-HPLC separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry confirms molecular mass and helps detect sequence variants or truncations. Some laboratories use amino acid analysis or peptide mapping for additional characterization. No single method proves biological activity; these techniques establish chemical identity and purity only. They also require suitable reference standards for confident comparison.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA under peptide hormones |
| WADA class | S2 | Peptide hormones, growth factors, related substances, and mimetics |
| Approved therapeutic use | Not established | Clinical research did not lead to broad marketing approval |
| Common detection method | LC-MS/MS | Liquid chromatography-tandem mass spectrometry |
| Sample preparation | Extraction and enrichment | Immunoaffinity or solid-phase extraction may be used |
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
ACE inhibitors block the conversion of angiotensin I (ATI) to angiotensin II (ATII). Arteriolar resistance is lowered, venous capacity is increased; cardiac output, cardiac index, stroke work, and volume is lowered; resistance in renal blood vessels is lowered; and lead to increased natriuresis (excretion of sodium in the urine). Bradykinin levels increase because angiotensin-converting enzyme also degrades bradykinin, and its inhibition reduces bradykinin inactivation. Under normal conditions, angiotensin II has these effects:
AOAC International's technical contributions center on the creation, validation, and global publication of reliable analytical test methods. Their areas of focus include, but are not limited to, safety of foods, beverages, dietary supplements, fertilizers, animal feeds, soil and water, and veterinary drugs. The aim of the test methods is to evaluate the purity of materials used in the production of foodstuffs, and their ingredients. The development of these analytical methods in achieved as part of a range of programs operated by AOAC. The Official Methods of Analysis (OMA) program is AOAC's premier program for developing food testing analytical science methods that are recognized and legally defensible worldwide. AOAC Research Institute (AOAC RI) Performance Tested Methods program develops, improves, and validates proprietary kit-based food safety testing methods. Proficiency Testing (PT) program helps labs compete in the global marketplace by demonstrating that through participation they meet the highest international standards for accuracy, reliability, and compliance.
For each diprotic acid titration curve, from left to right, there are two midpoints, two equivalence points, and two buffer regions. Due to the successive dissociation processes, there are two equivalence points in the titration curve of a diprotic acid. The first equivalence point occurs when all first protons from the first ionization are titrated. In other words, the amount of OH− added equals the original amount of H2A at the first equivalence point. The second equivalence point occurs when all protons are titrated. Therefore, the amount of OH− added equals twice the amount of H2A at this time. For a weak diprotic acid titrated by a strong base, the second equivalence point must occur at pH above 7 due to the hydrolysis of the resulted salts in the solution. At either equivalence point, adding a drop of base will cause the steepest rise of the pH value in the system.
The C-terminal domain of ADP-ribose diphosphatase contains the Nudix sequence, a highly conserved amino acid sequence that is found in over 450 putative proteins in about 90 different species. A part of this sequence known as the Nudix fold is the catalytic part of the sequence. It is a structurally conserved loop-helix-loop motif that creates a scaffold for metal binding and pyrophosphatase chemistry in the enzyme. ADP-ribose hydrolases in general act as protective agents against excessive intracellular accumulation of ADP-ribose, as high intracellular levels of ADP-ribose can be damaging to the cell. ADP-ribose diphosphatase, in particular, hydrolyzes ADP-ribose into AMP and D-ribose 5-phosphate, both of which are intermediates of central metabolic pathways and therefore are easily reused. Other common names for ADP-ribose diphosphatase include ADP-ribose pyrophosphatase and ADPRase. ADP-ribose is commonly referred to as ADPR.
Many different inventions and ideas which may or may not have been practical about auto safety have been put forward but never made it to a production car. Such items include the driver seat in the middle (to give the person a better view) (the exception being the McLaren F1 super car) and control stick steering. Automotive safety may have become an issue almost from the beginning of mechanised road vehicle development. The second steam-powered "Fardier" (artillery tractor), created by Nicolas-Joseph Cugnot in 1771, is reported by some to have crashed into a wall during its demonstration run. However, according to Georges Ageon, the earliest mention of this occurrence dates from 1801 and it does not feature in contemporary accounts. One of the earliest recorded car-related fatalities was Mary Ward, on August 31, 1869, in Parsonstown, Ireland. In 1922, the Duesenburg Model A became the first car to have four-wheel hydraulic brakes.
Sources: en.wikipedia.org
The amino acids in an α-helix are arranged in a right-handed helical structure where each amino acid residue corresponds to a 100° turn in the helix (i.e., the helix has 3.6 residues per turn), and a translation of 1.5 Å (0.15 nm) along the helical axis. Dunitz describes how Pauling's first article on the theme in fact shows a left-handed helix, the enantiomer of the true structure. Short pieces of left-handed helix sometimes occur with a large content of achiral glycine amino acids, but are unfavorable for the other normal, biological L-amino acids. The pitch of the alpha-helix (the vertical distance between consecutive turns of the helix) is 5.4 Å (0.54 nm), which is the product of 1.5 and 3.6. The most important thing is that the N-H group of one amino acid forms a hydrogen bond with the C=O group of the amino acid four residues earlier; this repeated i + 4 → i hydrogen bonding is the most prominent characteristic of an α-helix. Official international nomenclature specifies two ways of defining α-helices, rule 6.2 in terms of repeating φ, ψ torsion angles (see below) and rule 6.3 in terms of the combined pattern of pitch and hydrogen bonding. The α-helices can be identified in protein structure using several computational methods, such as DSSP (Define Secondary Structure of Protein).
The removal of dead cells by neighboring phagocytic cells has been termed efferocytosis. Dying cells that undergo the final stages of apoptosis display apoptotic-cell associated molecular patterns (ACAMPs), such as phosphatidylserine on the outer leaflet of the cell membrane. Phosphatidylserine is normally found on the inner leaflet surface of the plasma membrane, but is redistributed during apoptosis to the extracellular surface by a protein known as scramblase. These molecules mark the cell for phagocytosis by cells possessing the appropriate receptors, such as macrophages. The removal of dying cells by phagocytes occurs in an orderly manner without eliciting an inflammatory response. During apoptosis cellular RNA and DNA are separated from each other and sorted to different apoptotic bodies; separation of RNA is initiated as nucleolar segregation.
P-glycoprotein (3.A.1.201.1) is a well-studied protein associated with multi-drug resistance. It belongs to the human ABCB (MDR/TAP) family and is also known as ABCB1 or MDR1 Pgp. MDR1 consists of a functional monomer with two transmembrane domains (TMD) and two nucleotide-binding domains (NBD). This protein can transport mainly cationic or electrically neutral substrates as well as a broad spectrum of amphiphilic substrates. The structure of the full-size ABCB1 monomer was obtained in the presence and absence of nucleotide using electron cryo crystallography. Without the nucleotide, the TMDs are approximately parallel and form a barrel surrounding a central pore, with the opening facing towards the extracellular side of the membrane and closed at the intracellular face. In the presence of the nonhydrolyzable ATP analog, AMP-PNP, the TMDs have a substantial reorganization with three clearly segregated domains. A central pore, which is enclosed between the TMDs, is slightly open towards the intracellular face with a gap between two domains allowing access of substrate from the lipid phase. Substantial repacking and possible rotation of the TM helices upon nucleotide binding suggests a helix rotation model for the transport mechanism.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Yes, the World Anti-Doping Agency classifies AOD-9604 as a prohibited peptide hormone and related substance. Its use by athletes is banned under the relevant anti-doping code.
Confirmatory detection typically uses liquid chromatography with mass spectrometry. Immunoassays may be used for screening, but mass spectrometry provides structural confirmation.
No widely approved therapeutic indication exists for AOD-9604. It has been investigated in clinical studies, but regulatory approvals for general medical use are not established.
Lyophilized powder is commonly stored at −20 °C or below, protected from light and moisture. Reconstituted solutions are typically kept refrigerated and used within a limited period.