Everything below concerns RP-HPLC. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-05-16. Numbers and descriptions here follow the published literature rather than marketing material.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
The fragment includes residues that can form an internal disulfide bond between two cysteine positions. This structural feature can influence how the peptide folds and how stable it is in solution. AOD-9604 differs from full-length hGH in size and receptor interactions; it does not contain the entire growth hormone sequence. Published descriptions sometimes use slightly different residue numbering, so sequence information should be checked against primary sources. The molecule is small compared with intact hGH, which affects analytical detection and purification approaches.
Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Major agencies have not authorized it for therapeutic use. |
| Anti-doping status | Prohibited in sport | Listed among peptide hormones and related substances. |
| Primary research area | Metabolic and body-composition effects | Studies often examine fat mass or lipid markers. |
| Human evidence | Limited and mixed | Public data do not establish clinical efficacy. |
| Analytical detection | LC-MS and immunoassays | Methods vary in sensitivity and validation. |
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.
Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
Division of analytical chemistry and laboratory of bio-electrochemical biosensor research function in this department. The division conducts research in the area of methods of electrochemical analysis using chemically modified electrodes and biosensors. The head of the department is Professor Gennady A. Evtyugin, doctor of Science in chemistry. The Department conducts research in the following fields:
In 1884, Svante Arrhenius attributed the properties of acidity to hydrogen cations (H+), later described as protons or hydrons. An Arrhenius acid is a substance that, when added to water, increases the concentration of H+ ions in the water. Chemists often write H+(aq) and refer to the hydrogen cation when describing acid–base reactions but the free hydrogen nucleus, a proton, does not exist alone in water, it exists as the hydronium ion (H3O+) or other forms (H5O2+, H9O4+). Thus, an Arrhenius acid can also be described as a substance that increases the concentration of hydronium ions when added to water. Examples include molecular substances such as hydrogen chloride and acetic acid. An Arrhenius base, on the other hand, is a substance that increases the concentration of hydroxide (OH−) ions when dissolved in water. This decreases the concentration of hydronium because the ions react to form H2O molecules:
GABA-T is Enzyme Commission number 2.6.1.19. This means that it is in the transferase class of enzymes, the nitrogenous transferase sub-class and the transaminase sub-subclass. As a nitrogenous transferase, its role is to transfer nitrogenous groups from one molecule to another. As a transaminase, GABA-T's role is to move functional groups from an amino acid and a α-keto acid, and vice versa. In the case of GABA-T, it takes a nitrogen group from GABA and uses it to create L-glutamate. In animals, fungi, and bacteria, GABA-T helps facilitate a reaction that moves an amine group from GABA to α-ketoglutaric acid, and a ketone group from α-ketoglutaric acid to GABA. This produces succinate semialdehyde and L-glutamic acid. In plants, pyruvic acid and glyoxylic acid can be used in the place of α-ketoglutaric acid, catalyzed by the enzyme 4-aminobutyrate—pyruvate transaminase:
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
Microscale manipulation and patterning of biological materials such as proteins, cells and tissues have been used in the development of cell-based arrays, microarrays, microfabrication based tissue engineering, and artificial organs. Biological micropatterning can be used for high-throughput single cell analysis, precise control of cellular microenvironment, as well as controlled integration of cells into appropriate multi-cellular architectures to recapitulate in vivo conditions. Photolithography, microcontact printing, selective microfluidic delivery, and self-assembled monolayers are some methods used to pattern biological molecules onto surfaces. Cell micropatterning can be done using microcontact patterning of extracellular matrix proteins, cellular electrophoresis, optical tweezer arrays, dielectrophoresis, and electrochemically active surfaces.
Chattopadhyay's contributions in membrane and receptor biology and biophysics have been recognized by several awards and prizes. These include The World Academy of Sciences (TWAS) Prize, Shanti Swarup Bhatnagar Award, Ranbaxy Research Award, Prof. G.N. Ramachandran Gold Medal, SERB Distinguished Fellowship, Prof. G.N. Ramachandran 60th Birthday Medal and J.C. Bose Fellowship. He is an elected Fellow of The World Academy of Sciences, Royal Society of Biology, Royal Society of Chemistry, and all the Indian Academies of Science. Fellow, The World Academy of Sciences (2017) Fellow, The Royal Society of Biology (2017) Fellow, The Royal Society of Chemistry (2013) Fellow, Indian National Science Academy (2005) Fellow, Indian Academy of Sciences (1999) Fellow, The National Academy of Sciences, India (1998) Fellow, West Bengal Academy of Science & Technology (2010) Fellow, Andhra Pradesh Akademi of Sciences (2003) Fellow, Telangana Academy of Sciences (2015) Google Scholar
Sources: en.wikipedia.org
The medical equipment approach involves combining a continuous glucose monitor and an implanted insulin pump that can function together with a computer-controlled algorithm to replace the normal function of the pancreas. The development of continuous glucose monitors has led to the progress in artificial pancreas technology using this integrated system. Unlike the continuous sensor alone, the closed-loop system requires no user input in response to reading from the monitor; the monitor and insulin pump system automatically delivers the correct amount of hormone calculated from the readings transmitted. The system is what makes up the artificial pancreas device.
BDNF binds at least two receptors on the surface of cells that are capable of responding to this growth factor, TrkB (pronounced "Track B") and the LNGFR (for low-affinity nerve growth factor receptor, also known as p75). It may also modulate the activity of various neurotransmitter receptors, including the Alpha-7 nicotinic receptor. BDNF has also been shown to interact with the reelin signaling chain. The expression of reelin by Cajal–Retzius cells goes down during development under the influence of BDNF. The latter also decreases reelin expression in neuronal culture. The TrkB receptor is encoded by the NTRK2 gene and is member of a receptor family of tyrosine kinases that includes TrkA and TrkC. TrkB autophosphorylation is dependent upon its ligand-specific association with BDNF, a widely expressed activity-dependent neurotrophic factor that regulates plasticity and is dysregulated following hypoxic injury. The activation of the BDNF-TrkB pathway is important in the development of short-term memory and the growth of neurons.
Annex 13 of the Chicago Convention provides the international Standards And Recommended Practices that form the basis for air accident and incident investigations by signatory countries, as well as reporting and preventive measures. The International Civil Aviation Organization (ICAO) is specifically focused on preventing accidents, rather than determining liability. In Australia, the Australian Transport Safety Bureau is the federal government body responsible for investigating transport-related accidents and incidents, covering air, sea, and rail travel. Formerly an agency of the Department of Infrastructure, Transport, Regional Development and Local Government, in 2010, in the interests of keeping its independence it became a stand-alone agency.
Ectopic fat is the storage of triglycerides in tissues other than adipose tissue, that are supposed to contain only small amounts of fat, such as the liver, skeletal muscle, heart, and pancreas. This can interfere with cellular functions and hence organ function and is associated with insulin resistance in type 2 diabetes. It is stored in relatively high amounts around the organs of the abdominal cavity, but is not to be confused with visceral fat. The specific cause for the accumulation of ectopic fat is unknown. The cause is likely a combination of genetic, environmental, and behavioral factors that are involved in excess energy intake and decreased physical activity. Substantial weight loss can reduce ectopic fat stores in all organs and this is associated with an improvement of the function of those organs. In the latter case, non-invasive weight loss interventions like diet or exercise can decrease ectopic fat (particularly in heart and liver) in overweight or obese children and adults.
In molecular biology, and more importantly high-throughput DNA sequencing, a chimera is a single DNA sequence originating when multiple transcripts or DNA sequences get joined. Chimeras can be considered artifacts and be filtered out from the data during processing to prevent spurious inferences of biological variation. However, chimeras should not be confused with chimeric reads, which are generally used by structural variant callers to detect structural variation events and are not always an indication of the presence of a chimeric transcript or gene. In a different context, the deliberate creation of artificial chimeras can also be a useful tool in molecular biology. For example, in protein engineering, "chimeragenesis" (forming chimeras between proteins that are encoded by homologous cDNAs) is one of the "two major techniques used to manipulate cDNA sequences". For gene fusions that occur through natural processes, see chimeric genes and fusion genes.
Sources: en.wikipedia.org
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.
It is classified among peptide hormones and related substances that are prohibited in sport. The ban reflects anti-doping rules rather than a judgment that the peptide is effective for performance enhancement.
Human studies are limited and have not produced consistent evidence of meaningful clinical benefit. Some early trials examined metabolic endpoints, but larger confirmatory trials are generally lacking.
It is a synthetic peptide based on a C-terminal fragment of human growth hormone. It is commonly referred to as hGH fragment 176-191 and is studied for metabolic effects rather than growth effects.