reference-notes.peptides1004.com › Info › Mechanism And Regulatory Status — Background and Details

Mechanism And Regulatory Status — Background and Details

By Editorial Desk · published 2025-09-06 · last reviewed 2025-10-09 · Info

AOD-9604 comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.

Last reviewed on 2025-10-09. Where a claim depends on a specific study, the study is described rather than over-claimed.

Mechanism and Regulatory Status

Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.

Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.

Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.

Regulation and Detection Context

Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.

AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.

Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.

Aod-9604 at a glance

PropertyValueNotes
Typical storage temperature-20 °CLyophilized peptide; protect from moisture and light.
Typical analytical methodHPLC and mass spectrometryUsed to confirm identity and estimate purity.
Common synonymsAOD9604; hGH 176-191Naming varies by supplier and publication.
Disulfide bondsOneAffects folded structure and stability.
Typical research purity≥95%Value depends on supplier and analytical method.

Background and Molecular Identity

The fragment includes residues that can form an internal disulfide bond between two cysteine positions. This structural feature can influence how the peptide folds and how stable it is in solution. AOD-9604 differs from full-length hGH in size and receptor interactions; it does not contain the entire growth hormone sequence. Published descriptions sometimes use slightly different residue numbering, so sequence information should be checked against primary sources. The molecule is small compared with intact hGH, which affects analytical detection and purification approaches.

Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.

Related pages on this site

Measurement and Storage Practices

Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.

Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.

Handling, Analysis, and Quality Control

Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.

AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.

Supporting material

Yonath was accepted to Tichon Hadash high school since her mother could not pay the tuition, she traded her time teaching math lessons to students, which helped pay for her schooling. At a young age, she said, she was inspired by the scientist Marie Curie. However, she stressed that Curie, whom she as a child was fascinated by after reading her biography, was not her "role model". She returned to Jerusalem for college, graduating from the Hebrew University of Jerusalem with a bachelor's degree in chemistry in 1962, and a master's degree in biochemistry in 1964. In 1968, she obtained her PhD from the Weizmann Institute of Science for X-ray crystallographic studies on the structure of collagen, with Wolfie Traub as her PhD advisor. Yonath accepted postdoctoral positions at Carnegie Mellon University (1969) and MIT (1970). While a postdoctoral researcher at MIT she spent some time in the laboratory of subsequent 1976 chemistry Nobel Prize winner William N. Lipscomb, Jr. of Harvard University where she was inspired to pursue very large structures.

Many proteinogenic and non-proteinogenic amino acids have biological functions beyond being precursors to proteins and peptides. In humans, amino acids also have important roles in diverse biosynthetic pathways. Defenses against herbivores in plants sometimes employ amino acids. Examples: Tryptophan is a precursor of the neurotransmitter serotonin. Tyrosine (and its precursor phenylalanine) are precursors of the catecholamine neurotransmitters dopamine, epinephrine and norepinephrine and various trace amines. Phenylalanine is a precursor of phenethylamine and tyrosine in humans. In plants, it is a precursor of various phenylpropanoids, which are important in plant metabolism. Glycine is a precursor of porphyrins such as heme. Arginine is a precursor of nitric oxide. Ornithine and S-adenosylmethionine are precursors of polyamines. Aspartate, glycine, and glutamine are precursors of nucleotides.

Clinical studies have repeatedly shown that even though insulin resistance is usually associated with obesity, the membrane phospholipids of the adipocytes of obese patients generally still show an increased degree of fatty acid unsaturation. This seems to point to an adaptive mechanism that allows the adipocyte to maintain its functionality, despite the increased storage demands associated with obesity and insulin resistance. A study conducted in 2013 found that, while INSIG1 and SREBF1 mRNA expression was decreased in the adipose tissue of obese mice and humans, the amount of active SREBF1 was increased in comparison with normal mice and non-obese patients. This downregulation of INSIG1 expression combined with the increase of mature SREBF1 was also correlated with the maintenance of SREBF1-target gene expression. Hence, it appears that, by downregulating INSIG1, there is a resetting of the INSIG1/SREBF1 loop, allowing for the maintenance of active SREBF1 levels. This seems to help compensate for the anti-lipogenic effects of insulin resistance and thus preserve adipocyte fat storage abilities and availability of appropriate levels of fatty acid unsaturation in face of the nutritional pressures of obesity.

It is a member of the small pentraxins family (also known as short pentraxins). The polypeptide encoded by this gene has 224 amino acids. The full-length polypeptide is not present in the body in significant quantities due to signal peptide, which is removed by signal peptidase before translation is completed. The complete protein, composed of five monomers, has a total mass of approximately 120,000 Da. In serum, it assembles into stable pentameric structure with a discoid shape.

Benninghoven graduated from the University of Cologne in 1961 where he worked with Fritz Kirchner (1896–1967) and completed his habilitation in surface physics in Cologne two years later. He first worked as professor in Cologne from 1965 to 1973 until he moved to a full professor position in experimental physics at the University of Münster in 1972. He worked on static secondary ion mass spectrometry (SIMS) and its applications, and developed SIMS instruments. In 1989 he co-founded IonTOF, a company that became a world-leader in TOF-SIMS instrumentation. He has written over 300 scientific articles and several books on the topic of SIMS, many of which have become reference works on SIMS. For his work, he has received the Technology Transfer prize (German Ministry of Education and Research) and the 1984 Gaede-Langmuir Prize (American Vacuum Society) for the development of concepts and instrumentation in static secondary ion mass spectrometry and the demonstration of its usefulness in manifold applications. In 1990 he shared the Fritz-Pregl-Medaille of the Austrian Society of Analytical Chemistry with Wilhelm Simon. From 1977 to 1983, he was president of the German Vacuum Society (part of the German Physical Society).

Sources: en.wikipedia.org

Notes from published material

Within the field of supramolecular polymerization, Schmatloch et al. used automated synthesis to create main-chain supramolecular coordination polymers, reacting bis(2,2′:6′,2″-terpyridine)-functionalized poly(ethylene oxide) with various metal(II) acetates. From this, it was revealed that classical laboratory approaches could be transferred to automatic synthesis, optimizing the processes to increase efficiency and aid with reproducibility.

Acta Biochimica et Biophysica Sinica was a Chinese-language journal entitled "Shengwu Huaxue Yu Shengwu Wuli Xuebao" (see box below), which began publishing sometime in 1958 or 1959, or August 1961, until December 2003 (depending on the source). Tables of contents were in English. Summaries (abstracts) were in English and Russian, and text of articles in Chinese. Later issues were promulgated in the Chinese and English languages. The translated title was "Journal of Biochemistry and Biophysics". The frequency was quarterly from 1959 to 1963, bimonthly from 1964 to 2002, and finally, monthly by 2003. Publication was suspended from 1966 to 1975. It was indexed in Chemical Abstracts Service. It may have published 35 volumes in total, over the years. In 2004 the journal switched to a full English-language journal under its current title. Official website Institute of Biochemistry and Cell Biology Archived 2003-12-17 at the Wayback Machine, SIBS, CAS

After translation, the AGP protein backbones are highly decorated with complex carbohydrates, primarily type II AG polysaccharides. The biosynthesis of the mature AGP involves cleavage of the signal peptide at the N-terminus, hydroxylation on the P residues and subsequent glycosylation and in many cases addition of a GPI-anchor. Glycosylation of the AGP backbone is suggested to initiate in the ERTooltip endoplasmic reticulum with the addition of first Gal by O-galactosyltransferase, which is predominantly located in ER fractions. Chain extension then occurs primarily in the GA. For those AGPs that include a GPI anchor, addition occurs while co-translationally migrating into the ER.

Alemtuzumab, sold under the brand names Campath and Lemtrada among others, is a medication used to treat chronic lymphocytic leukemia and multiple sclerosis. In chronic lymphocytic leukemia, it has been used as both a first line and second line treatment. It is given by injection into a vein. It is a monoclonal antibody that binds to CD52, a protein present on the surface of mature lymphocytes, but not on the stem cells from which these lymphocytes are derived. After treatment with alemtuzumab, these CD52-bearing lymphocytes are targeted for destruction. Alemtuzumab was approved for medical use in the United States in 2001. (Mab)Campath was withdrawn from the markets in the US and the EU in 2012, to prepare for a higher-priced relaunch of Lemtrada aimed at multiple sclerosis. Alemtuzumab is used for the treatment of B-cell chronic lymphocytic leukemia in people who have been treated with alkylating agents and who have failed fludarabine therapy. It is an unconjugated antibody, thought to work via the activation of antibody-dependent cell-mediated cytotoxicity.

Sources: en.wikipedia.org

Background from the literature

The catalytic mechanism of FGE is well studied. A multistep redox reaction with a covalent enzyme: substrate intermediate is proposed. The role of the cysteine residue for the occurring conversion was studied by mutating the cysteine to alanine. No conversion was found using mass spectrometry when the mutated peptide tag was used. The mechanism shows the important role of the redox active thiol group of cysteine in the formation of f(Gly), as seen in Fig. 2. The key step of the catalytic cycle is the monooxidation of the cysteine residue of the enzyme, forming a reactive sulfenic acid intermediate. Subsequently, the hydroxyl group is transferred to the cysteine of the substrate and after hetero-analogous β-elimination of H2O, a thioaldehyde is formed. This compound is very reactive and easily hydrolyzed, releasing the aldehyde and a molecule of H2S,

Originally, seven such proteins were discovered. Of these, six (BMP2 through BMP7) belong to the Transforming growth factor beta superfamily of proteins. BMP1 is a metalloprotease. Since then, thirteen more BMPs, all of which are in the TGF-beta family, have been discovered, bringing the total to twenty. The current nomenclature only recognizes 13, as many others are put under the growth differentiation factor naming instead.

A protein is represented by a three-dimensional open chain, and determining whether that chain contains a mathematical knot requires the chain to be closed by an auxiliary procedure. The result can depend on how the closure is performed, particularly for shallow knots or chains with complicated geometry. AlphaKnot therefore provides both probabilistic and deterministic closure procedures and reports the resulting knot type together with additional information about the location of the knotted region. AlphaKnot was initially developed to analyze the rapidly growing number of protein structures predicted by AlphaFold. The expansion of structure-prediction databases made it possible to search for protein knots on a scale that was not practical using experimentally determined structures alone.

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

Affimers are recombinant proteins. As they are manufactured using recombinant bacterial production processes, the batch-to-batch consistency for Affimers is improved compared to polyclonal antibodies, overcoming some of the issues of reproducibility and security of supply. These synthetic antibodies were engineered to be stable, non-toxic, biologically neutral and contain no post-translational modifications or disulfide bridges. Two separate loop sequences, incorporating a total of 12 to 36 amino acids, form the target interaction surface so interaction surfaces can range form 650–1000 Å. The large interaction surface results allows binding to target proteins. Affimer technology has been commercialised and developed by Avacta, which is developing these affinity reagents as tools for diagnostics and as biotherapeutics.

Sources: en.wikipedia.org

Frequently asked questions

Is AOD-9604 approved for weight loss?

No. Major drug regulators have not approved AOD-9604 for weight loss or any other therapeutic indication. It remains an investigational compound studied in research settings.

Why is AOD-9604 banned in sports?

The World Anti-Doping Agency classifies it as a prohibited peptide hormone. Athletes under anti-doping rules are not permitted to use it. Its presence can trigger a doping violation.

Does AOD-9604 raise growth hormone levels?

It is a fragment of growth hormone rather than a substance that signals the pituitary to release more hormone. Studies have not shown a consistent rise in IGF-1 or full growth hormone. Its metabolic effects, if any, appear separate from those of the complete hormone.

Is AOD-9604 banned in sport?

Yes, the World Anti-Doping Agency classifies AOD-9604 as a prohibited peptide hormone and related substance. Its use by athletes is banned under the relevant anti-doping code.

Network